DPCstruct | MC6520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 176 ± 22 aa |
| Standard deviation of domain lengths | 21.50 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.66 |
| Pfam Score | 94.07 |
| Assigned Pfam label(s) | CL0220- CL0073 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9X209 | 3-166 | APEVYCNIISSNQIRQLQERLDSFRIDIERAPVLENNSQILTYRDDKRLATFNNLKLQKTKRFDNTIPVLEEKCALLFHVQILINNQ… |
| A0A833ZR99 | 53-207 | SRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGNGGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNI… |
| A0A834EM73 | 2-156 | None |
| A0A2B4S7F2 | 488-672 | None |
| J9JYX7 | 244-409 | None |
| A0A6V7VGR7 | 244-441 | None |
| A0A8B6D8H4 | 397-582 | None |
| A0A5E4AUQ4 | 109-273 | None |
| A0A835NJ91 | 333-517 | None |
| A0A1E1MX08 | 354-534 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.