DPCstruct | MC652
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 181 ± 15 aa |
| Standard deviation of domain lengths | 15.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 74.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 31.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8NPM4 | 181-365 | IQAGGEEHEPVYRSIGLCSLLLVAQFLLQLLLIPQGTLFGQIMFIGSLAVSWAYNSYLASIEKEKVQREILMEKVLKEPWVKKYQLG… |
| A0A0D0DS29 | 1-176 | FSLRFQSEPQYKNIGWCSILLTIQFLAQLLLIPQGSLFGQIMFVSSLGVSWAYNSWLSSLDKEKIQKEILFDHVLGEPKVTKYYFGT… |
| A0A0C9Y7J8 | 414-589 | None |
| A0A4Q9MC81 | 2-176 | None |
| A0A2G8RXQ7 | 85-266 | None |
| A0A4V2K4F7 | 357-555 | None |
| A0A409YWS7 | 756-939 | None |
| A0A0C3NKH1 | 97-277 | None |
| A0A0C9WBF3 | 7-211 | None |
| A0A060S886 | 2-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.