DPCstruct | MC6518
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 135 ± 18 aa |
| Standard deviation of domain lengths | 18.37 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351HN44 | 17-139 | KISTYSSSESHNTGKNCMDCHKSGEPGEGWFIVAGTVYDTSLSTIYPNATVELTSKPNGSGTIMAQIAVDKNGNFYTTESVSFGQGL… |
| A0A357QJE4 | 30-150 | NISAHGLNKSHNMGNDCMDCHRDGGEGTGVYFLAGTVYDSLMTNPLPDGDVKLFTGPDGTGTLKYTIPVDALGNFYTTELISFGSGL… |
| A0A7Y4ZV68 | 82-209 | None |
| L7VQF0 | 14-204 | None |
| L7VV14 | 25-165 | None |
| A0A7Y4ZJ01 | 49-181 | None |
| A0A521TTT8 | 260-391 | None |
| A0A3A8RWP7 | 22-160 | None |
| A0A432PZN6 | 17-140 | None |
| A0A1M3NCI5 | 178-318 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.