DPCstruct | MC6517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 173 ± 15 aa |
| Standard deviation of domain lengths | 14.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N5ZF70 | 1-159 | MPHINSPQQDTLKFQFEDQGQYSYDKQEESPLYLESPSNIKDTVEYDPATNEYIISKKIGNYDYRPSKRMTQEEYQEYQFEQALRSY… |
| A0A351PY55 | 27-182 | AQNNDSLHYPIHDRYSDVLSSGGRSAFDLNDPSNIKDSVVYDAINRRYTVYEKIGDKYYRVPITYSFDEYWQMRNSQAEEEYFRKRA… |
| A0A5P2G898 | 1-192 | None |
| A0A3B8ZSF8 | 24-204 | None |
| A0A2G1C1J5 | 11-181 | None |
| A0A090VRN6 | 1-158 | None |
| A0A2G6F5C9 | 1-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.