DPCstruct | MC6516
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 13 aa |
| Standard deviation of domain lengths | 13.16 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 34.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N5SAK2 | 2-82 | NDELASLYTADKQERVNQPKGNTTAYKEMRTRDLGRRERVMEIVAANQVQTAEDYFHAAWIMNHGDTPDDAKNAHFLAVRA |
| A0A2N5ZBA9 | 1-106 | MVRIILLAIIIGFITLNFKSGIAQNKVCDNQELIKIFKSDQDDRTNHIDRSIIQKNDSIREARVYELLDSNKVRTSTDYCNAALIFQ… |
| A0A2A3VK27 | 1-113 | None |
| A0A4R1UGS0 | 266-351 | None |
| A0A7W8E7I7 | 1-119 | None |
| V4R7D9 | 3-110 | None |
| A0A7G9QUA7 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.