DPCstruct | MC6511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 41.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C1DTV1 | 2-60 | VRLAQEHGWSFGVTSSGHPRLRPPPEAKAEAVVFSNTPSDTRSDKNSIARLRRAGVPVP |
| A0A2A2DHI6 | 8-73 | ADGRLRQLVAFAVSEGWSVSRTAGGHIKFSKAGHASIFTSCTASDHRADLNALARLRRAERGQSQP |
| A0A2W6RL58 | 1-75 | None |
| A0A7M2C998 | 6-73 | None |
| A0A3T0KI41 | 2-67 | None |
| A0A1N6UFA6 | 16-80 | None |
| A0A5B8SNI4 | 1-65 | None |
| S2L760 | 66-128 | None |
| A0A3M2WWD4 | 85-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.