DPCstruct | MC651
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 99 ± 15 aa |
| Standard deviation of domain lengths | 14.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D0A4Y5 | 65-168 | KKELLKTIEDETGVKPGEHGMMNHYSKYLTEMVESLTEKEVEEATEIVIDWNKQGVPPEVQSDIARWKSDDILQYVAKEMFKRAGMR… |
| A0A0D0D8N1 | 110-213 | KAKITALIQEKKGVKPGEAEMISNYRWAVSQVMGNMTEAELEEAEKEAMQWNSKRPPLEVQADTAARKGKQYAHKFASTMLKQCGMW… |
| A0A0C9Z7U1 | 36-139 | None |
| A0A0D0CXE2 | 110-213 | None |
| A0A0D0CSG7 | 5-94 | None |
| A0A0C3AHV6 | 9-101 | None |
| A0A0C9YE13 | 134-237 | None |
| A0A1J8RH34 | 27-137 | None |
| A0A0C3EHS3 | 1-69 | None |
| A0A0C3PAF5 | 116-219 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.