DPCstruct | MC6505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 187 ± 17 aa |
| Standard deviation of domain lengths | 17.11 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0KQC5 | 45-221 | DEELAVQLPPPFLESGALPRLVVGEELEVAPAIFVAAVTPAVPGASGWSIDEIGLVDAIGTVLTSLPGGADPASPVSVLDTGGRLFP… |
| A0A385LG57 | 2-160 | TTLWMIEDLEPWPDQPVPGQVCEPTTSWTTPGASDCIRELVRHIPARVEQITVDDRIELLAHLGHGFTTVLPPQLDTLGDVVLTGHL… |
| A0A0M4QFX1 | 1-211 | None |
| A0A6I6FXM7 | 131-307 | None |
| A0A0N9MPQ8 | 3-187 | None |
| A0A0B0Q5G2 | 1-189 | None |
| A0A5P2C394 | 35-216 | None |
| A0A318S6V9 | 4-200 | None |
| X0PUS3 | 13-197 | None |
| A0A0S2LYV1 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.