DPCstruct | MC6503
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 295 ± 40 aa |
| Standard deviation of domain lengths | 39.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496WPE1 | 39-336 | YVYQIGNRTHIALGSANATSAALIAEKNIEILAELAGPASRVGSVSRLFNVDADDGLGQYLVRWNQDDIHEIDTAKQAMQRLLEDAR… |
| A0A1R4GBC9 | 1-285 | MIVHDLPRKQSRVLLGSANATGAAFRDNTEVMVELVGPVKQFGVKSTLEALDQLKEEYAPTGGETSTEQEEAEHRLEQMLRAIAASP… |
| A0A1V5LZ07 | 5-256 | None |
| A0A329P092 | 67-325 | None |
| A0A523Q1B6 | 233-531 | None |
| A0A6L7WT94 | 66-372 | None |
| A0A6L8A1D6 | 256-621 | None |
| A0A0Q9KB61 | 229-555 | None |
| A0A0M8XJT7 | 1-187 | None |
| A0A6L5F8D0 | 395-734 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.