DPCstruct | MC6502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.82 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7LTS8 | 90-184 | PDLDPLVTGSLAETPTAPAAGPVAALPERTGPPPSSGFALRRAAAGQAVVEGRDGLHEIAVGSTLPGAGRVLSIRSTSAGWIVITTE… |
| A0A2K8Y5N7 | 1-90 | MLGAAPTTLGAQAAALGSKPQLAAGPETRPSTIPGWSVVEVRDGTAVLEGPDGVKMAARGDLVPGLGRVDSIVRWGNRWIVATASGL… |
| A0A1H4NYD6 | 168-265 | None |
| A0A2N8MD88 | 321-449 | None |
| A0A2W5MJS3 | 7-113 | None |
| A0A0S9QRN2 | 52-145 | None |
| A0A537SH65 | 34-149 | None |
| A0A2E0LZT5 | 538-653 | None |
| A0A5P9JV09 | 1-111 | None |
| A0A4Y3TWX4 | 64-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.