DPCstruct | MC6501
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 159 ± 10 aa |
| Standard deviation of domain lengths | 10.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3G5U4L2 | 1-176 | MNYNIQKGQFRLTTAHPRGSWWEFYRVPCPICNGIGNCMLHVSQEKVACTRVESKWVYGKNSSNPSYIHYLNGKKQYQLPDVDVVKG… |
| A0A4R8G5X6 | 7-160 | TRVKDWYEYYRTPCVICGKTGGCMAHVDGSAVACIRTESDTYFSKNSALPSYLHLLKGNNKRKINKEEIEEIHVGHPKQKDKVLNTV… |
| A0A2D5X893 | 1-155 | None |
| A0A6D1SVA2 | 11-173 | None |
| A0A2N0EHR7 | 1-143 | None |
| A0A521TTM1 | 161-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.