DPCstruct | MC650
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 16.86 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9ZM77 | 1-85 | NIPITDIPDIVSWFAFLDHHEQRNQDGLTFAPYGPILRAKGFLHLSQLTLDFFGLSDLQTWLGIEVRTAVLIMQYAKEDLAAIRS |
| A0A0D0DPT7 | 2-103 | ATGYTDPKSGPQACFSLIDNIPNSEMPKIFAWFTSLDEHDVWKKDHLRFTPFGQHLYDEGFQYLSQLSPSMMSLKELAESMGTSKGT… |
| A0A0C2YQ25 | 486-583 | None |
| A0A0D0DCM3 | 19-131 | None |
| A0A0D0D828 | 186-304 | None |
| A0A0D0CS09 | 60-178 | None |
| A0A0D0CR11 | 5-133 | None |
| A0A2G8RV25 | 542-683 | None |
| A0A0C9ZVN8 | 132-249 | None |
| A0A0C2SUZ5 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.