DPCstruct | MC65
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 145 ± 27 aa |
| Standard deviation of domain lengths | 26.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 88.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A527HXN0 | 14-125 | FSPGSQCLLTRSTDGYLRQKSAKIILPLNEPWTIPFIVLLLGEYVVEILDDIHLAMPYFDQTAYASFVRQNRQVMRAIRAKATSYWN… |
| A0A1G6QUU5 | 17-152 | EELDPALERSLTGTQRVIAHCLYSRHHDGYVRQRSLELLMDSAEPWVAPFVVHLAGEYVLEILEDIRRGLGGLTVPGSVERQLYGEF… |
| A0A143GKS2 | 1-100 | None |
| R7F464 | 7-147 | None |
| A0A1Y3KM16 | 34-167 | None |
| A0A519EDM2 | 28-184 | None |
| A0A4R7ZAG0 | 28-221 | None |
| A0A7Z2SYE6 | 1-118 | None |
| A0A2G1LI36 | 9-223 | None |
| A0A2N0H8J5 | 53-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.