DPCstruct | MC6499
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 87 ± 4 aa |
| Standard deviation of domain lengths | 4.29 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 30.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X0FTJ9 | 62-145 | SRCDLALARDDVNGFLHYIHPIPLRLGYADEYVAKHIQGWTWRELYELVGEAGVVEGGLPPRCYVAVGAVHVSHDGSWLVEWED |
| C7NJJ6 | 32-119 | TSGHGYAESRTGEEISRLLHYGHIIPVRRGLTADYVDRHFPGWTWNALMDVWRTAGIVVRTPGGIPDCDPRVRAVHFTDAEHVHVEWA |
| A0A0Q6R673 | 414-501 | None |
| A0A4P5RKM1 | 19-109 | None |
| A0A7G9F546 | 3-84 | None |
| A0A1R4IN76 | 1-88 | None |
| A0A6J7VXZ5 | 24-117 | None |
| A0A2S5XGD8 | 112-193 | None |
| A0A6J7F189 | 6-94 | None |
| A0A6H9WYR2 | 158-251 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.