DPCstruct | MC6498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 129 ± 11 aa |
| Standard deviation of domain lengths | 10.58 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 34.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0317 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5BMT1 | 33-162 | RSGCMVCGKDLIYLDTDQDLSCSFCGQVIPANARCVNGHFVCDNCHRADAVEIIKQVCLHSRECDAVALMQTIRSHPRFRIHGPEHH… |
| N6WL59 | 4-135 | KTGCLICRKELIYLENAEKKGCYYCLEKYDTNVTCVDGHFVCDKCHSLPANDLIEQTCINSKLEDSPKLSLILMKNPKIKMHGPEHH… |
| A0A662TXC6 | 4-123 | None |
| A0A1M5XM61 | 4-137 | None |
| A0A315XBW7 | 77-210 | None |
| A0A7C7RE21 | 486-621 | None |
| A0A1V1P6E0 | 22-169 | None |
| T0DX24 | 3-122 | None |
| A0A497A058 | 2-126 | None |
| A0A101GN68 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.