DPCstruct | MC6497
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 122 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.42 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R6MZ00 | 89-209 | ETTAADSREAVRAFLDRGVDLVAFVGGDGTAVDVAETLRTAGGETPVLGVPAGVKVYSGVFGATPAAAGRLVAGYEPGDPTVEREVN… |
| A0A7W6UKR6 | 47-170 | HLSNTGLSTSADTRSAVGSMVTEGVDLILFAGGDGTARDILSESGRKVPILGIPAGVKMHSAVFGTTPANAGHLAALFLSGSASAQV… |
| A0A559QKP8 | 95-224 | None |
| A0A534LLU3 | 481-594 | None |
| A0A7J3P945 | 50-182 | None |
| A0A7Y6CEP3 | 7-144 | None |
| A0A509DZW0 | 100-227 | None |
| A0A3S2XPG2 | 159-277 | None |
| A0A0A1D1X9 | 3-104 | None |
| A0A662IAQ0 | 88-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.