DPCstruct | MC6496
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 161 ± 37 aa |
| Standard deviation of domain lengths | 36.64 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016T7Q9 | 22-183 | EDAATEMRLKDYANRLGDIREARIRRELRNAQYGGKAVPASAPELSLENCSKKVWRLEADSPFIEVDLRSLALDWRPRAKDNTFQQV… |
| A0A016RSS3 | 459-637 | TSSDSVVRCLVGVVKSLSEVIIGMSTVMDGMVVNQENLRNSVKTANNCITRMTRLKLPNGVSLSASNMKTSWKIPVQPPFVECDLKE… |
| A0A368FL74 | 68-239 | None |
| A0A2H2IF15 | 144-318 | None |
| A0A368FUT1 | 176-332 | None |
| A0A368FZ13 | 29-184 | None |
| A0A368G168 | 776-944 | None |
| A0A368G697 | 4-127 | None |
| A0A016TXC3 | 68-253 | None |
| A0A368F9I4 | 1-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.