DPCstruct | MC6494
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 155 ± 18 aa |
| Standard deviation of domain lengths | 18.24 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q0GFM9 | 77-265 | DEDVLETLLKIFKALFINDFTRQMNILALLPEVKSTYLELLHLQPSKSKITFSCYESENMFSPEELLFHTLGFSITRNQSSLVSAGT… |
| A0A016T3W6 | 46-183 | EEIDSQLRATLEALASKFSTIDFRKPLTVELRDHASDQLEKHLGFKLVRKPSTIDHGGRGILVERGRIPPRTVVSLYPGTIYDPWDS… |
| A0A2B4SN93 | 2-146 | None |
| A0A0C9N952 | 300-429 | None |
| A0A077WVN1 | 1-139 | None |
| A0A1Y2GR90 | 55-207 | None |
| A0A7M7T476 | 259-420 | None |
| A0A814UFH1 | 18-156 | None |
| K1Q979 | 2-170 | None |
| A0A6J1U5S9 | 16-164 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.