DPCstruct | MC649
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 135 ± 9 aa |
| Standard deviation of domain lengths | 8.76 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9V855 | 1-140 | MSIRLEQALQALQAMQHLNIDVSQFIIFILASTTPEIRDSQLSLIQHATAIFDAFSTVPEAQNDVVSWVHTIAKNTYMEEVCALTSP… |
| A0A0D0DNC2 | 1-133 | MAIFEALADCRMTVSQFLLAPLTHQHYDKHPVTKDILLHSTDIIGTILVHPMRNPNIIQHLTKLAKNSYLKEICDVASMQGGWNFGV… |
| F8NHW3 | 34-148 | None |
| A0A0C9WKX6 | 1-137 | None |
| A0A0D0CZ97 | 4-130 | None |
| A0A369JJD1 | 1-145 | None |
| A0A0C2WYL1 | 7-148 | None |
| A0A2R6Q5X2 | 1-129 | None |
| A0A4S4MC58 | 1-137 | None |
| A0A165TUT4 | 2-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.