DPCstruct | MC6489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 13.79 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 35.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7T9GEM4 | 145-280 | GVTADGIPPTIDLARFIKTCAEEDVAFKATAGLHHPIRAPYRLTYAPDSPTAVMHGFLNVFLAASFAYNGMDIDRLVAVLEETAPSA… |
| A0A6L3A6C5 | 19-149 | GVEAHQIPPVAQVAAFIAECAAADVPFKATAGLHHPLRHESREVGTKMHGFLNVFVAAALAHAERPPARDLESVLAEEAPAVFSISD… |
| I4EWY0 | 1-98 | None |
| A0A2E8JZU2 | 169-305 | None |
| A0A372JRX8 | 98-232 | None |
| A0A0M8TMK5 | 150-274 | None |
| A0A238WS99 | 21-153 | None |
| A0A7V9KUA5 | 91-219 | None |
| A0A2A3T0D9 | 89-242 | None |
| A0A2V7H959 | 85-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.