DPCstruct | MC6488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 52 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.51 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R2NWQ0 | 58-225 | LCTSCHAKVTRGQFSKAYVRKKYDEVQTAILADVPPPFDYLDFHDGKAELKIGGISYDPGVTSIVKYHGKEIFSVSPSVGETTAGIC… |
| A0A660WFK2 | 17-187 | YTKEQLRDFKQNGIAHSKEVRGRFDWLRNDLHAVVGSLYCTNTLDIFTFNRKRVIWFNRDKENYFLLNVQIVSPSGEEMLLIEDNDW… |
| A0A7V1LZS4 | 8-157 | None |
| A0A1P8U7I4 | 4-196 | None |
| A0A521UW94 | 18-168 | None |
| E4WLK9 | 66-240 | None |
| A0A2C1DHH9 | 64-215 | None |
| A0A1J4R0J0 | 75-247 | None |
| A0A2M7R5G2 | 55-221 | None |
| A0A1E3R380 | 31-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.