DPCstruct | MC6486
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 11.70 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A660W4S1 | 18-96 | TKFKRIATSILPVDKGRKGACKRCGACCKLPNPCPFLRIDKNGQCTCKIYWFRPPSCRKYPRTKSELLTPETCGYSFDR |
| A0A1G3BR71 | 33-121 | ALLLQAWRRIYFVSNKKEVYTSIEKRKGDCMRCGRCCQASCKCKHLAYDENGLSICKIHDRKPHMCKIYPYNRDDFFYHLKHTCGYK… |
| A0A2N1U0E2 | 5-79 | None |
| A0A7W0F1R6 | 3-96 | None |
| A0A3M1SYU2 | 90-191 | None |
| A0A349MES9 | 4-111 | None |
| A0A523CPT6 | 49-146 | None |
| A0A1G2ZW00 | 2-72 | None |
| A0A0S7YEC7 | 2-89 | None |
| K1XRE3 | 31-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.