DPCstruct | MC6484
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 164 ± 17 aa |
| Standard deviation of domain lengths | 16.51 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.08 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0E9K2 | 7-167 | KIIDIPLTYTQFIKEIKTNTFMKCLNNTHNHYGIQYDIGLNQDTQPFNPYSFGKGGLHFTTDEDIVHFTNYGVNIAIIELCQDALFS… |
| A0A7U0HWQ3 | 5-174 | EIKNKDFYKMSKTIDMKDNPIFKKHIDYHYIEYIPNELTIAEDKEMGVYFTSGVTLLRFIVYGNQLTIINFDESNLNYSTVMNNKYE… |
| A0A417P5J1 | 10-189 | None |
| A0A6B4KLR2 | 7-166 | None |
| R6YED7 | 4-178 | None |
| G5HC99 | 88-263 | None |
| A0A7I8DGR9 | 34-217 | None |
| A0A3F3S628 | 2-139 | None |
| A0A7X2TEW2 | 2-173 | None |
| A0A419SS45 | 5-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.