DPCstruct | MC6483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 147 ± 14 aa |
| Standard deviation of domain lengths | 13.87 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 13.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4SL48 | 2-146 | TTRYQVQLTQDDDIKSAYELLLWDHSHIYFQDYSIAFQDIQEINISMCSMMQMLNILSIYMNYYVDINIITPKEEYAFQIMNHDTLL… |
| A0A3E3E9V5 | 18-180 | SERVRLNVYVDQLGDQQEEYLLIGEELILRLDNKIRKITFDEIKEINVSMCSRLYNPGIVESNLEKLIIKRWTYGSTLAVGQHLNYY… |
| A0A0R2BU13 | 39-171 | None |
| A0A2N7AS40 | 21-170 | None |
| B0N3F9 | 3-130 | None |
| A0A4R3Z132 | 6-137 | None |
| A0A4S2FA23 | 6-163 | None |
| A0A0R2EXN8 | 20-170 | None |
| R7GML9 | 1-163 | None |
| A0A0R1QDB6 | 77-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.