DPCstruct | MC6481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 3.91 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 34.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810QAT5 | 2-57 | AKKYRVTITETLKRTVDVTAESKEAAEQIVGDEWYSGKHILTADDFIGVEFEANTI |
| A0A3E3E4J1 | 1-59 | MKQYDVEITETLQRTISVEANSREEALTKVKEKMRNEEVVLDSNDYIDTEYIVTVRKKM |
| A0A3C0JA16 | 70-128 | None |
| A0A3E3E8F4 | 1-54 | None |
| A0A3A9FTI5 | 14-68 | None |
| A0A3D2KKN9 | 65-119 | None |
| A0A229G8B8 | 61-113 | None |
| K1X6L5 | 10-72 | None |
| A0A1C5WQU6 | 1-54 | None |
| A0A4V3R9Y0 | 79-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.