DPCstruct | MC6480
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 711 ± 40 aa |
| Standard deviation of domain lengths | 39.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.52 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07580 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496LBQ2 | 73-786 | RSDLIQSILEKLSPVELQSDTIYKHLNRLGDGKVNAIKNLYLEESFKFVKENLGKFITKLVHNQDHQLNTDEAAKRALIKKIDDNKA… |
| A0A3E3E3Z5 | 128-828 | LPDEIKKIEFTDSELLDTLGIREGREYVIKAINLAKADGKVWKDLTNEEKEAYYNKAKAIILKETIENNIYLSKFNEIKNDVIPYLD… |
| A0A3P1VGE7 | 369-1082 | None |
| A0A1S8KNB2 | 345-1040 | None |
| R6KKQ7 | 81-821 | None |
| E0TKZ2 | 143-859 | None |
| A0A1Y4RMU6 | 177-841 | None |
| Q59986 | 1115-1853 | None |
| A0A3L9DUS9 | 160-941 | None |
| A0A0T9A5R6 | 4-615 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.