DPCstruct | MC648
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 225 ± 24 aa |
| Standard deviation of domain lengths | 23.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S6W048 | 86-301 | DKSSWIWGMLKGDFNKNPTMSQIIVSGLISMIPVVDQVCDVRDLIANLIDLSKENGKSSDNYKALALTAFGVIPEIGSAVKTIVKAA… |
| A0A375HI30 | 26-264 | GLWLWEAIQGDFNEDRSAGQIAADMVISLIPIVDTICDIRVLCANIRAYRKDPGNKLILFFIALTIIGFFPEVGSVIKGVIKIAFVY… |
| A0A4Q4XBN7 | 42-269 | None |
| A0A250IYN2 | 1-242 | None |
| A0A378QIP5 | 109-342 | None |
| E0SGL7 | 192-407 | None |
| F3LMC2 | 29-276 | None |
| E2CL44 | 170-431 | None |
| B7VTR7 | 2-199 | None |
| A0A837GA28 | 2-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.