DPCstruct | MC6477
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 187 ± 16 aa |
| Standard deviation of domain lengths | 15.85 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 17.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2U8VP04 | 2-185 | IQVMQFQFFENGKVKQGQSQHTMMLEAYCEGRLNLFNPYWKRTVQLAESKLTYRWAQRKLEAGEMTAEQFAEYEAAHETCTAIAVCE… |
| C7C8E8 | 5-175 | PRLPYQIDPLPAVGTMTGIQVALHDNGTKLSVNGRKTTTTRFKVTIEAYTSPKPINKRAYMFKRSLELRDPDTFTRLIDSQLQTGLI… |
| A0A086ME69 | 1-195 | None |
| A0A844ZEZ7 | 42-228 | None |
| A0A437LV22 | 22-235 | None |
| A0A2N9AJW1 | 52-242 | None |
| A0A5C4LC98 | 28-202 | None |
| A0A2Z3I4G0 | 11-209 | None |
| A0A4Y9RF77 | 50-201 | None |
| A0A4U2GRH0 | 21-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.