DPCstruct | MC6476
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 77 ± 9 aa |
| Standard deviation of domain lengths | 8.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 48.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377M1T6 | 231-314 | WFNDTRRGMENQLNSLADQGLLMNFVGMLTDSRSLVSYTRHDYFRRILCNMIGGWVERGEVPDNNDILTRMIKNICHDNAKNYF |
| B6W4P7 | 1-80 | MGKQMNALSLLGLLSRFVGMLIDSRGFLSYPRHEYFRRTLCNLLGNDIENGELPASELPFIAQVIENISYYNTKNYFQFK |
| A0A6G1N0P0 | 58-125 | None |
| A0A7X7L648 | 138-219 | None |
| A0A378MVH0 | 1-85 | None |
| A0A645DDM7 | 22-105 | None |
| A0A0B8Q9X8 | 378-461 | None |
| A0A256BJM2 | 2-62 | None |
| A0A8A7KAN0 | 9-86 | None |
| A0A850QWV3 | 6-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.