DPCstruct | MC6474
Metacluster Properties and Pfam Annotations
| Number of structural domains | 118 |
|---|---|
| Mean domain length (aa) | 365 ± 73 aa |
| Standard deviation of domain lengths | 72.54 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.90 |
| Pfam Score | 85.84 |
| Assigned Pfam label(s) | PF04782- PF03989- PF16898- PF00521- CL0413 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9JH90 | 65-359 | YSDFVNKELVLFSNMDNERSIPSAVDGLKPGQRKVMYTCLKRNDKREIKVAQLAGSVAEHSAYHHGEQSLMSTIINLAQNFVGSNNI… |
| A0A431EAD3 | 20-388 | REINTNRSVVNIDGLKKLHRRILITANRLGKKEPTSTLSGEVAKLHPHASQDDTISMLVRAGILEGLGNHGSDTLVPCPPAASRYTK… |
| A0A535VXI0 | 419-734 | None |
| A0A0K0EEJ7 | 404-773 | None |
| T1NGA2 | 6-298 | None |
| A0A6A4GCK8 | 96-457 | None |
| A0A521F3Y2 | 32-393 | None |
| L0AX56 | 112-567 | None |
| A0A1A9UKE5 | 5-326 | None |
| A0A1I8FBP6 | 23-424 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.