DPCstruct | MC6473
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 122 ± 8 aa |
| Standard deviation of domain lengths | 8.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 24.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D9NG05 | 8-131 | TINAKDAYKAVKVYMFGFSASFNDSTVNFTDIQAVDAYVENNHTHFLVNRDEYSYQLRYYMESIQPDSNPTCLVVYALSQKNAIKKY… |
| A0A1I2P7N1 | 20-141 | AAINVSAANKKATIYAFGFSASFNDSIVYFTDIQQIDNATIESKSKFLLNRAEYADQFRDYFNSIGLEHRTCIISYGLTLKDAEKKL… |
| A0A3D1H1K1 | 1-139 | None |
| D3ID09 | 34-149 | None |
| A0A133PZ41 | 21-146 | None |
| U2KNK5 | 2-118 | None |
| A0A2S8H1T1 | 4-121 | None |
| D1QUR8 | 10-140 | None |
| A0A7Y4TLK3 | 12-134 | None |
| I0TFI7 | 2-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.