DPCstruct | MC6470
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 152 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1F5A4 | 1-131 | MVPLNTFREMKKLRPMRQIEVAETMIAMNRFSWPYAKSLVAATPQHLLTSEKRKTVRGLSDEQIEHMEREATNIDREFRMIEQSYGT… |
| A0A528W648 | 80-240 | EEQQGPLCFTAGPQLVGGICLDVLDLLNDFGAPLKIFPLLREVVPSRQVEIVRLMIALDRVQFRVVRVLIALTSRSQLTDPFARRKQ… |
| A0A6S7BE11 | 24-177 | None |
| A0A0L0MC80 | 24-182 | None |
| A0A6J5ER49 | 126-279 | None |
| A0A2W7QVZ8 | 105-238 | None |
| A0A543KWJ8 | 481-620 | None |
| X6CH55 | 12-156 | None |
| A0A2A3BL19 | 40-195 | None |
| A0A357IEB6 | 19-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.