DPCstruct | MC647
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 139 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 39.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1W1XVD1 | 1-136 | MTNTTTPLELHACMGLNACKGHDRLGSNECAGSGSCATAAAHSCHTLNNCRNQGGCGLYGTGEEQDHPGDNPCAWLGSCAVPINAER… |
| A0A3L8KVN1 | 6-150 | TPHTPGPQDDPPPLPQEVPRELHVCMGLNSCAGLDILGSAPMAGMGACATVHHVCHGEGACRGQGGCGYAGTEYEQFHPGEQDCRYN… |
| A0A4V2AGK6 | 6-146 | None |
| A0A0A1FGW5 | 497-652 | None |
| A0A6N9NKJ2 | 345-477 | None |
| A0A2V8MPL4 | 2-138 | None |
| A0A266Q992 | 254-413 | None |
| A0A2E0XET2 | 32-156 | None |
| A0A518E1J8 | 28-162 | None |
| A0A7G8K8W3 | 56-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.