DPCstruct | MC6469
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 127 ± 14 aa |
| Standard deviation of domain lengths | 14.29 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 67.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q7Y887 | 25-175 | IRDEDRAHIGLTDAAAEKLATTLTEKIRGYARAGFRKPADVSRLLNKEAIRTAAGTEWNPRLVYFLLDRIFADSPRKPKAPQPTATT… |
| A0A528NDE2 | 1-138 | MTDAEMVHFHSKRINVAQLCDKFGPIVKSYARTGTRKPRDVAVRLNAEGHRTVAGSRWTPHLTHILLGLIFLDPAKIRQSGVALGKD… |
| A0A0C6FBJ7 | 240-367 | None |
| A0A1F8IWQ5 | 22-140 | None |
| A0A160URY6 | 266-409 | None |
| A0A6F8NC35 | 177-273 | None |
| A0A125Q718 | 84-202 | None |
| A0A7W9Z4J6 | 1-119 | None |
| A0A0Q4X8C5 | 217-352 | None |
| A0A4Q3YRI5 | 44-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.