DPCstruct | MC6468
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 10 aa |
| Standard deviation of domain lengths | 10.01 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 30.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E2VUD8 | 15-164 | LEKEYGREFSDVEVLEAGNTLCGLAEILYDHWREESRREKKLKESPKGFVLEGVGYTCFICGGGTPANGNWYDKYGIKCSVCQRAIN… |
| A0A1F7WAJ0 | 2-158 | LSKRLGREATDEETFESANALMNLCEALYSVALRLRHWDERLKTEPHGFALPISISGGSYNCGICYATIAGEQGWYDQYGIKCRICQ… |
| A0A1F7J3M5 | 1-170 | None |
| A0A0L0LKU5 | 212-355 | None |
| A0A0Q5TB46 | 5-145 | None |
| A0A2M7X4Q7 | 363-511 | None |
| K2EZE9 | 17-168 | None |
| A0A4U1CD35 | 150-287 | None |
| A0A1F6V8N3 | 1-168 | None |
| A0A7Y7H4C5 | 120-269 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.