DPCstruct | MC6467
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 123 ± 16 aa |
| Standard deviation of domain lengths | 15.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 38.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X8SQR9 | 1-125 | MRTDSDLWFLDQCSNKQLEFLYNILTLEIDGSYRKRERLSNSLESEIYGTDYYKYSDRIALELQYQSNDVIGDLLRQNLRDYRDILV… |
| A0A401LQ36 | 2-133 | KEDKDLEFLAFCKNEDLQILVDYLTTDKDGKKRYLETLTKSNAYLQCYPDHLTSMWEDIANEFQLFGGNTIANCIRKTGVTYRTILF… |
| A0A1H6GLX4 | 1-140 | None |
| A0A0A8GQI9 | 1-151 | None |
| I0EML4 | 2-111 | None |
| A0A250FM74 | 1-123 | None |
| A0A5N9VVU2 | 4-124 | None |
| A0A4U8S7W3 | 73-224 | None |
| A0A6M8SXC4 | 5-134 | None |
| A0A7G9GZF0 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.