DPCstruct | MC6466
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 101 ± 13 aa |
| Standard deviation of domain lengths | 12.57 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R4XLF5 | 48-143 | VLGCNFSVDREDLIAVNGFDERHGVQWGAEDSDVERRLKKIGVRVKSLRFAATMIHFDGQYFKRGPSEDARERWKLYQQAEKENRTW… |
| A0A3C1B9L2 | 119-239 | WQPRSISEKLKSMPFDYRVMGALDSLSPVRCSWAGGNASTFRDHILKVNGFDTEMAYGGEDKEFGARLINLGVKGRHLRYTAPLYHL… |
| A0A1V5TRW0 | 2-90 | None |
| A0A7V4GWD6 | 4-96 | None |
| A0A7J6Z5Y6 | 561-657 | None |
| A0A800AY03 | 1-123 | None |
| A0A838NL29 | 42-149 | None |
| A0A800ETD7 | 115-211 | None |
| A0A2G7H809 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.