DPCstruct | MC6464
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 466 ± 74 aa |
| Standard deviation of domain lengths | 74.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662V3H9 | 11-458 | KGVTVDLGAGLRSIFNAREWYIPGKDTVRVGHLWVWTARTVWNPFGGFDDVYSVDIERQTWDPFMWRHPFNGEPIPFRVTYDVVTAG… |
| A0A662GDW3 | 311-771 | TVTALAYDIGGGLWSRWGLVTLMTTTGTATIAEFSSAAALFMSAFNPVGGFEDVYSELVRGVLHDPGMYTHPLTGEPIPVRVNYTDV… |
| A0A7C3VDF0 | 13-303 | None |
| V4J5V2 | 73-577 | None |
| A0A7J3WGI3 | 13-560 | None |
| A0A2Z2MLA1 | 273-736 | None |
| A0A7C4CUM1 | 5-323 | None |
| A0A7C1GAS8 | 336-849 | None |
| A0A7C5VGN7 | 105-652 | None |
| A0A2T2UDB7 | 8-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.