DPCstruct | MC6463
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 67 ± 4 aa |
| Standard deviation of domain lengths | 4.18 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 39.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A385HRQ8 | 70-138 | LGQIITYAAGTDPTTIVWVTTGFRPEHRAAIDWLNQRTDENTRVFGVVIQVVQIGDSQPAPNFDLVVQP |
| A0A6I3N348 | 84-152 | LGQLITYSSHYNAKTIVWVVRDLRIEHEKAIEWLNRNLSDEIKIFLVKIELFKIGDSLPAPKFSLLSKP |
| A0A2D5G474 | 2-66 | None |
| A0A6I4ZUF2 | 16-85 | None |
| A0A838KIA9 | 31-99 | None |
| A0A839P2N4 | 38-106 | None |
| A0A845C963 | 160-228 | None |
| A0A7W1UFC8 | 5-60 | None |
| L0RWF7 | 63-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.