DPCstruct | MC6462
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 5.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A662UNG3 | 3-73 | IVKARGTMVTFTPKKVAKIAGVSTRPAHLSVVRYILENLREKGLVELWKKTFHGYRYAITSESPLWQEVKK |
| A0A662G582 | 2-72 | IRSTKGTMLTFNAKKIAVIAGLPTHPVILTLIKEVIEQLCTRKLVRRMSRSSHGVKYAITRESPFWLLAKA |
| A0A662H889 | 34-101 | None |
| A0A124IT72 | 17-90 | None |
| A0A830GZS6 | 24-101 | None |
| A0A662H879 | 105-173 | None |
| A0A497GRN2 | 2-58 | None |
| G7VCM3 | 53-125 | None |
| A0A662NG37 | 13-83 | None |
| A0A497FNX4 | 65-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.