DPCstruct | MC6461
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 6 aa |
| Standard deviation of domain lengths | 6.35 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 16.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3Y7I1 | 1-88 | MRIIWCKNLEDVVSVAMGHGWLLHLQMDGRHYYYVYAGVESEIICIATRSDSPISARYVTIGDEGELKTSGKPIMPACARIVEVAEDR |
| A0A662FWA2 | 5-108 | KTVKLKYIEDLIHVLNVAQLPIVHHVSVDSRHIYFIPVGMLGDIGIIYYIELEKPLSGKFILYNTFTGEIRSSSVWTSDSRYMVVPI… |
| A0A662UT18 | 2-117 | None |
| A0A2H1FDI4 | 46-151 | None |
| A0A2M7JUT8 | 1-104 | None |
| E6N3N2 | 72-178 | None |
| A0A833EBH6 | 10-112 | None |
| A0A662HGS5 | 6-108 | None |
| A0A2R6AI42 | 3-104 | None |
| A0A662HTW9 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.