DPCstruct | MC6460
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 70 ± 4 aa |
| Standard deviation of domain lengths | 3.92 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 39.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7PEW4 | 109-177 | CNINGALDKQWEAASLAEVLAAPPSALQGLGPKSDEAMGELGIKSVQDLASWKYAAWADALLTLAEFEK |
| A0A662FTL0 | 7-72 | EKALDKEWEKKSPIELANAPVNALSGITPEDRELLKKALNIETIQDLASNRLIMFAQAIKALAYLQ |
| A0A061R4P1 | 138-207 | None |
| A0A419HCR0 | 1-70 | None |
| A0A7J7QL27 | 59-132 | None |
| A0A7W8Z2Q6 | 33-100 | None |
| A0A847VS61 | 247-323 | None |
| A0A7S1SA98 | 223-298 | None |
| A0A812X5C5 | 574-642 | None |
| A9USF4 | 245-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.