DPCstruct | MC646
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 121 ± 8 aa |
| Standard deviation of domain lengths | 7.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 80.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 28.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W0VTB8 | 1-120 | MAWSRVPRWSDEQLREAIAAATSFRDAAARLGAIETRKRVRRRARELGINTTHFLAPRDKARRWSDDDLRAAVVGARSIAHVLRTLG… |
| A0A538A500 | 1-119 | MPWKPSYTKEDAAEALSAAESWADALRRLGVSPYGKNFSTIRKWAARWEIDTTHLPPHRPRRAGPRFTELQAREAITRSRSWTEALR… |
| A0A0F0HHH5 | 1-110 | None |
| A0A4R9E3U2 | 1-118 | None |
| I0KZI4 | 3-141 | None |
| A0A3N2AUA0 | 1-123 | None |
| A0A4R7MVI0 | 9-135 | None |
| A0A7V8WZ66 | 1-120 | None |
| A0A2N3TQ61 | 6-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.