DPCstruct | MC6459
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 108 ± 13 aa |
| Standard deviation of domain lengths | 12.70 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 34.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A177UGP2 | 1-108 | MLSTLAEVDATSRELDARTITLACGHVFTVETLDGHFQMSAFYTKGPDGEWQRNPSLPTDFFTAFSCPACRSPTSAMRYGRPKKRAC… |
| A0A2J6RDE7 | 26-140 | KTYGEISLKETPIVVLGCGHFFTAESLDGMVGMSAVYECNRDGDIVGLKDVSAQLASAIPKCPDCKSPVRQFVSPRYNRVINRAVID… |
| A0A3M7ASZ2 | 86-185 | None |
| A0A8A3NXW6 | 151-263 | None |
| A0A835XVU1 | 51-159 | None |
| A0A420N1R6 | 234-333 | None |
| A0A5K1JY96 | 408-517 | None |
| A0A7S2PSP7 | 410-494 | None |
| F4RL78 | 477-590 | None |
| U9SWU0 | 174-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.