DPCstruct | MC6458
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 211 ± 19 aa |
| Standard deviation of domain lengths | 19.33 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 18.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7CMH0 | 2-206 | TLVSQLSFRDMYHRGCFFAMNDYLAELLEAAKIGADGADGALGYGYIDNEAGFTFEILASAKREGDRFIPLPNDGTVSLKVRRGSAA… |
| A0A847GLH2 | 13-195 | TATDSAQIPVGAWLRLDLPGQPGLIAFTYLDRQAGFFAQGRTIEGAMLDRKAATILRLPLPGVCWQPLSAAEVRALGLDTPPNWLQG… |
| A0A7D7G093 | 1-215 | None |
| A0A350IYI1 | 1-211 | None |
| A0A1Y4DYJ0 | 195-399 | None |
| A0A832TMX3 | 1-172 | None |
| A0A2U1S914 | 232-455 | None |
| A0A3D5HV09 | 13-210 | None |
| A0A7X6T8C1 | 12-268 | None |
| A0A351E8H2 | 56-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.