DPCstruct | MC64574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.42 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W3WRX0 | 37-129 | GLVNDLHAVNTSLQDGGFGPQLLCSLIDFRDSEGRPLAIVYLYKRGTFYPFAPIPGQREKRDNALELQMRALLADDLPVEEDLGRWF… |
| A0A499W5G0 | 1-99 | MSDLHAVNSALEGSGFGPQLLCSVAGFRSAATGRDGGLRRLGLVYLYKRGTFYPFAPLAGAGRRRDNALELQVKAALADDLRIEQDL… |
| A0A538MLJ4 | 69-163 | None |
| A0A7V8ZKV8 | 31-124 | None |
| A0A842Q3P7 | 6-86 | None |
| A0A6N8YR19 | 76-169 | None |
| A0A0M9UBH6 | 102-194 | None |
| A0A842KNW4 | 5-90 | None |
| A0A535WHL4 | 102-187 | None |
| A0A7W0H1N3 | 1-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.