DPCstruct | MC64572
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 105 ± 7 aa |
| Standard deviation of domain lengths | 7.45 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 51.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2FIF1 | 1-109 | KTGGKPREHFLLRLERPASATLLALVRDAAARLPGGEGSRTDVCELLKESTFIVDGANDSQISTVASGALDRLQSEQDACVRYDGER… |
| B3SCD9 | 61-160 | ASSKAREHALLKQDRPPFVTILTIARDAAARLPNGEGTRADICELLKDSQYLVECSDSQINSVVSGALDRLHYEKDPCVKYDSSRKL… |
| A0A183BAI0 | 290-387 | None |
| A0A2R7WGR7 | 116-213 | None |
| A0A183NGC1 | 51-149 | None |
| A0A0P0WH74 | 972-1080 | None |
| A0A0V0QNH1 | 391-494 | None |
| E9FX69 | 92-193 | None |
| A0A2B4SE39 | 475-572 | None |
| A0A1X6PD92 | 219-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.