DPCstruct | MC64569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 145 ± 26 aa |
| Standard deviation of domain lengths | 25.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M0K8Y7 | 138-264 | APSDRATLSASTVAEIEEMVDRRLRAKLGKDFGAADALLDELRSMHGVAISDDQRLWRADGEQFELHEYHEEGSPTNPTPPWIAEAI… |
| A0A7S2DKH1 | 2-141 | MAAPPSGAGVDTAAVEALLEARGKAKQAKDYARADELAETLRTTYSVVTDDKRRTWRVVVMYGGHYRVGPSVDPFTTKQVGDMLIKR… |
| A0A7S4MWC4 | 1-113 | None |
| A0A7S0DUT6 | 74-191 | None |
| A0A0M0JZ43 | 20-204 | None |
| K0RTG2 | 161-302 | None |
| A0A1E7FCN4 | 3-128 | None |
| A0A7S2UK85 | 46-182 | None |
| A0A7S3SP76 | 259-411 | None |
| A0A7R9YN08 | 2-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.