DPCstruct | MC64566
Metacluster Properties and Pfam Annotations
| Number of structural domains | 76 |
|---|---|
| Mean domain length (aa) | 139 ± 20 aa |
| Standard deviation of domain lengths | 19.83 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 17.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0673 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A538NJM3 | 2-109 | NQSWYLRKHEDGSIFGPVGFDQLARWASTAQIAPHDALSTDQRTWTKAPMLPQLGMDWLVEVTSEHYYGPTTLGAIQEFIRLGEISD… |
| A0A7S2CVL1 | 52-197 | EGWHYTDEAGEPHGPVPWVVLHGMRGAGSLPPGTLVWSSQNTENGWRAYEEVEAERIEVDSNGAHDDNGNEAALAADTTAWFYVGES… |
| A0A7V4HG77 | 928-1028 | None |
| A0A1V6JVR3 | 4-170 | None |
| A0A523URQ4 | 2-146 | None |
| A0A5C6FIZ1 | 1-123 | None |
| A0A514XI53 | 1-139 | None |
| A0A7V4J1W9 | 279-395 | None |
| B7FRZ8 | 143-334 | None |
| A0A7X7B9Y8 | 11-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.