DPCstruct | MC64563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 136 ± 22 aa |
| Standard deviation of domain lengths | 22.21 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 42.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2C3X0 | 11-155 | APSYSAGADGSADIVLDYTIVGTSQTLEKKYLRLTSAPNPATVRPEPVLRAAIELIRSRYESYGEERGQEQYIYLWEQMKSVRQDLT… |
| A0A0A9XRB8 | 1-104 | MSQQMERTYSRYEPKMEDIRPLSVLKLALVYVTTRAHAKLHEDSKLASMKYLNDQLKGIRQDLRVQNIVNNFTVQVYEQHARLALKM… |
| A0A090L8K9 | 292-462 | None |
| A0A3Q0J5P8 | 400-509 | None |
| A0A4Y7NKZ3 | 594-735 | None |
| A0A446K3T6 | 638-734 | None |
| A0A022R2U6 | 775-930 | None |
| A0A7S1ZFJ1 | 32-156 | None |
| G4VNF7 | 490-644 | None |
| A0A0S4KMB3 | 36-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.